DPCstruct | MC24376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 130 ± 4 aa |
| Standard deviation of domain lengths | 4.19 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812I5Z1 | 1-130 | MASKELTEEGADNLLAQLDTAYRRVEESQGSRVKLESAEINLLKVLEQARDMLTTALMASADRAALKEIFGGSCRRTGRIRAVLDAA… |
| A0A812NPQ7 | 2-131 | EAKIDGVLSRMEIAAEKVELYCNSKVKLPMAELDYLKTLEDARDFMTMMVAKTSDNRQQLADIFGGDCSRIARIRTVLDGVVLSDMN… |
| A0A813DEN7 | 3-135 | None |
| A0A1Q9CCN8 | 14-146 | None |
| A0A812LFJ2 | 2-130 | None |
| A0A812PQ29 | 210-339 | None |
| A0A812MU16 | 11-132 | None |
| A0A812N323 | 1-129 | None |
| A0A812YJG9 | 1-124 | None |
| A0A7S1AJ36 | 3-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.