DPCstruct | MC24374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 283 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9EGZ6 | 449-747 | ALVVQCHAWARISVTVGGEELSETSIQDKEKELTKANTNFGELETIGECCGDQKSEADVVRNAINTNEVYGSSGDVEKDIFSRTSCR… |
| A0A812GT58 | 1-307 | MLGRLVPFAVIALCDAYKREATSLTGQEFAGMNFKDKADSLRQASPRYGKLEMMGECCSAPGEAEQVENDVNTNSVYGSKAEISEEV… |
| A0A812SAG3 | 106-378 | None |
| A0A812IS98 | 15-305 | None |
| A0A1Q9CGK3 | 8-271 | None |
| A0A813AJB5 | 1-297 | None |
| A0A812PEQ7 | 10-297 | None |
| A0A812MNM3 | 12-284 | None |
| A0A813M1U7 | 1-236 | None |
| A0A812RD82 | 177-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.