DPCstruct | MC24373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 258 ± 29 aa |
| Standard deviation of domain lengths | 29.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7PUE7 | 60-331 | SLSAEKPTGEWALKAIDKWKLQPPYDTAITEALWQEYYETRIKIKVPGGSYLYGEEIKQFDEEKIGKKNRKSPVYKALVLAREQMSV… |
| A0A812GET3 | 20-282 | TVMPGKFDLDITNVTGHWDPSVLEEEWKAWYDLRKQAESHCSQLLREGCEGEGDEEKDEEEEFDVDDHDEDYYQSSRFQLKMLKDLR… |
| A0A0K6FW40 | 348-638 | None |
| A0A2H3D4Y4 | 4-247 | None |
| A0A1B7MP43 | 22-302 | None |
| A0A0B7FB92 | 3-266 | None |
| A0A0D7API7 | 36-352 | None |
| J0WZA6 | 2-234 | None |
| A0A5M3MC07 | 47-330 | None |
| K0R8K5 | 13-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.