DPCstruct | MC24372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 132 ± 9 aa |
| Standard deviation of domain lengths | 8.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.33 |
| Pfam Score | 73.61 |
| Assigned Pfam label(s) | CL0027- PF21399 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8VXV1 | 29-153 | KEEDLLMRQIDDFLFISPSPERTLKFYNILKQGFPKYNCFINKEKLVTNCFLIKDLPLQDNISFCGYIFNTVTLGVDVSLEGYTGID… |
| A0A7D9JHQ7 | 5-123 | LLLTHDLELAKRYLTTTLEPAYNCEVKVEKCLVNFGIPAGMKMKELHECDSWIPWCGILINKVTLEVKYDYSKTQYMKNVKNNLTFD… |
| A0A397CJC6 | 6-132 | None |
| A0A0E9NB64 | 849-978 | None |
| A0A7S4KFV3 | 287-433 | None |
| A0A226PAA2 | 147-292 | None |
| A0A7S2PJ46 | 1-127 | None |
| R1GLU3 | 7-135 | None |
| A0A433DMP4 | 14-140 | None |
| A0A177W7E1 | 6-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.