DPCstruct | MC2437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4LVA2 | 1-69 | MTPKQFYVKWGVSYEQIASICSRYDSTVQGWFKRGKNRRFPTAVDLRHLAVMDFLLEHFEEIPDVLANL |
| B7KDK7 | 1-70 | MELEEFEKYWEVSRDELAYICCCSRTTVDHWYSQQKTRRIPKDEHKRLLALAHHIWTALETEPAYLQKLR |
| A0A6P0PV10 | 1-64 | None |
| A0A6M0B7K3 | 41-116 | None |
| B4VY47 | 110-180 | None |
| B4VP31 | 174-246 | None |
| A0A6P0L2D7 | 57-124 | None |
| K9X7H4 | 165-241 | None |
| A0A846GSA7 | 2-75 | None |
| A0A846GPT0 | 79-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.