DPCstruct | MC24365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 126 ± 17 aa |
| Standard deviation of domain lengths | 16.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 27.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9DZ38 | 4-102 | ETGKKSLETKLTLLQLNVKRTEVTLQSEQPNAIERHCKALKAVIAAVDDSRRTVEEQKIIEKESLDDIGEWNIEINAKLAEADNEVK… |
| A0A7D9IL39 | 3-113 | PKLEVTALETKITQLKRAIGKTETIVNNGKEQAIVRHVDTIKETLSEVNKLRREIEATKISDGVNDDEIDEWNSEIESVMESGDEAI… |
| A0A6S7GEZ9 | 2-130 | None |
| A0A6S7GGK9 | 3-129 | None |
| A0A6S7GP64 | 1-120 | None |
| A0A6S7HG28 | 6-127 | None |
| A0A3M6UC19 | 1-128 | None |
| A0A7D9LQ48 | 1-132 | None |
| A0A3M6U5X8 | 10-114 | None |
| A0A6S7GAE6 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.