DPCstruct | MC24364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 215 ± 39 aa |
| Standard deviation of domain lengths | 39.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8ETR9 | 1-203 | MAKRIRLSSVSTDSWETDWSKCCLCQEDTVETLKLTADGYKMLATNIPKFHEMNSLPIPLDVRRFNNGSGIESTLTTNEAKCHPTCR… |
| A0A7D9IGZ8 | 6-242 | CIICQKSSVEKLQFPANSKRKDAGVGYTSFVRNLEEFRKLEITPECLNVECLDEGLGIEQTLLNKKASWHKSCRDLFSSTKLERANK… |
| A0A4Y1ZM23 | 7-164 | None |
| A0A6S7I4D1 | 2-221 | None |
| A0A7M7HIG3 | 1-273 | None |
| A0A2G8LRF0 | 2-227 | None |
| A0A2G8L5S4 | 3-233 | None |
| A0A2G8L568 | 9-178 | None |
| A0A1A7XPK8 | 5-276 | None |
| A0A6S7GRS3 | 9-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.