DPCstruct | MC24363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 241 ± 26 aa |
| Standard deviation of domain lengths | 25.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3RZZ8 | 13-240 | CGDVLASAKSICGINYKTPGMIAKFSNLLANDVQTFTNTALNLAPASQIKTSCRADIKNFYCRLFFPSCNAASELISYNLPNCTTYG… |
| A0A7D9ICG0 | 31-264 | AFVLYRMPSRCVEAPQNDICDLGYKIRYMGDKKFGDIVSLSFSSIKNMYQEFGYSDECIEKTMELLCRSAFPECKPNGRVDYGDQHG… |
| B3S5F1 | 49-266 | None |
| B3S6E3 | 36-282 | None |
| B3S5E8 | 71-313 | None |
| A0A369SBG9 | 32-295 | None |
| A0A369SD24 | 24-269 | None |
| B3S5E5 | 5-234 | None |
| A0A7D9DT51 | 1-282 | None |
| B3RPQ1 | 16-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.