DPCstruct | MC24362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 139 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 33.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9I7A6 | 39-173 | KGSNSNPNGNAGQGTAGTDRHNMVEMADPSVNYPLTSEKPLKMFTNAEIVWRSDEETKTKQDLILSMASSGYYNSMTLCKASPQKTE… |
| A0A7D9IAD5 | 269-407 | LVHIQWTGSNTNPSANAGQGTAGTDRHNMVEMADPSVNYPLTSEKPLTMFTNAEIVWTSDEETKTKQDLILSMASSGYYNSMTLCKA… |
| A0A812LZ11 | 455-593 | None |
| A0A812M1W5 | 50-186 | None |
| A0A6S7G9A2 | 441-582 | None |
| A0A812QWP0 | 422-558 | None |
| A0A1I8FTY9 | 299-449 | None |
| X6PE21 | 166-333 | None |
| A0A210PGA4 | 312-446 | None |
| A0A820Q8S0 | 203-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.