DPCstruct | MC24361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 232 ± 24 aa |
| Standard deviation of domain lengths | 23.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 21.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7H8M9 | 36-229 | LIPNPITEKHKFYNELLYELFNDSYELMTHDAFILYVTGQRQSRWKIKQSLDSMRLYEIKLAESKDRHWQNIRKYVGDQVMLTSKDM… |
| A0A7D9I737 | 83-308 | STGKAKGNTENSLPDTHSTNETCTDVDLGYLPHGEKHRDTCFSNNLLQRFYPLVKTFMPSKTFFRKNFIEERCRQWKIYKKKEKIEK… |
| A0A6S7HAH8 | 20-218 | None |
| A0A8B6BN27 | 63-289 | None |
| A0A8B6BUL1 | 899-1130 | None |
| A0A6S7IEX7 | 2-285 | None |
| A0A6S7IBC6 | 58-285 | None |
| A0A6S7I6C7 | 102-348 | None |
| A0A6J7ZVN0 | 42-254 | None |
| A0A7D9DBC6 | 89-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.