DPCstruct | MC24360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 238 ± 29 aa |
| Standard deviation of domain lengths | 29.16 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0052- CL0027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498M940 | 5-236 | HDIILEREQQVQKYLSKYITDFPTPVEFHITEMTHVTNKTRVEEIWKSGGFKGLDKNSFSWWSLKINKTDIRAAEERYFERLIPNRS… |
| A0A7D9HYR4 | 16-295 | RICPGIHITQSQWQAEWNEPFQPEQNDDLSDPVCSIPQFIWSFASVIIVNPAGATRTSIPIVDLVHATNRQSAVEIIMCDGFTGQLK… |
| A0A498LZF9 | 65-299 | None |
| A0A6J2R1B4 | 18-235 | None |
| A0A3P8SJF5 | 4-266 | None |
| A0A5C6NLH2 | 3-263 | None |
| A0A498NST7 | 503-727 | None |
| A0A498NDP9 | 35-269 | None |
| A0A3B3Y0V3 | 3-243 | None |
| A0A3N0YXW9 | 191-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.