DPCstruct | MC2436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 212 ± 52 aa |
| Standard deviation of domain lengths | 52.09 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09721 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7K7Z1 | 27-238 | LFKIIGILLIGCIVINLPLSPQKNKLDPFLRCSPFIFGLSLGLIASGLKGIKLYWRELTILFFLGMPAVIAEWLKFNPSSLTAQFST… |
| A0A356GNS6 | 166-313 | GAVPRFASTFLALQTLTVFFPETAFAPLNHHTAWMAARLLTLCGLPPVLQGNLLGRGSFTVEVVTECSALYMGILFLSFVVAGTATP… |
| A0A2T6CZM0 | 328-591 | None |
| A0A0R2FLQ3 | 17-176 | None |
| A0A3C1F399 | 2-135 | None |
| A0A7V2XGM0 | 226-490 | None |
| A0A1X6ZLR2 | 15-313 | None |
| A0A7C5LBY1 | 99-279 | None |
| A0A538NK40 | 24-317 | None |
| A0A2W6AST4 | 348-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.