DPCstruct | MC24358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 140 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B9G8Z1 | 8-147 | SAAEEHVFAAYGRAMHGAQALEYWLRVLVQVHRVATKHFASHEELEPAFNTLSTSTMGTVFAALRSLTQNPPLEDKLTLAVAERNRL… |
| A0A0Q8VLY1 | 25-166 | ADYQVREVYAQYGLTNYSSQVLEKGILNTLVLKANSESPTPTAQNFDVLFAKYARLPFGQLLASFQKALPAETEAYDVLARALPLRN… |
| A0A5E4IE73 | 10-138 | None |
| A0A523K051 | 1-158 | None |
| A0A2S0U9A3 | 11-152 | None |
| A0A2A6FMQ2 | 2-134 | None |
| A0A5C8J468 | 3-142 | None |
| A0A1M5C057 | 3-141 | None |
| D7HHM4 | 14-157 | None |
| A0A7L5A315 | 13-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.