DPCstruct | MC24357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 270 ± 56 aa |
| Standard deviation of domain lengths | 56.11 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7XKP4 | 11-284 | SSFCFGVERAVNGLSAIVASHQPNGQAGPGDKVFCVHALVHNPKVTKDFEDRGVAFVESIYDIPDDDAVVVFSAHGINRVVLEQARA… |
| A0A3L8I1Q9 | 1-167 | HEIVHNKYVVRTLEKKGAIFVDETAEVPEGNIVIFSAHGVAPVVHDEAARGKLATIDATCPLVTKVHKEAVRFAKDDYDILLIGHEG… |
| A0A3D4H4G6 | 85-487 | None |
| A0A831W8W2 | 2-228 | None |
| A0A7X8I5Q9 | 13-277 | None |
| A0A358SNV1 | 138-415 | None |
| A0A7V2XK24 | 76-354 | None |
| A0A7Z9Q9S5 | 2-192 | None |
| A0A6A6MRY4 | 3-291 | None |
| A0A3B0JAQ2 | 157-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.