DPCstruct | MC24354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 122 ± 20 aa |
| Standard deviation of domain lengths | 20.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.81 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0014- CL0382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0X3BP16 | 39-144 | PSPVIKRMMWGSLSTDMLQTYGHLVDKDIDAAIAQLYGVVTPETETSDSLEPRQCPRCLSVWGPALQHCGVCGAPLTREGMADLDDA… |
| E7QNG8 | 118-275 | ERMSYVTFQRYFKRAAKRIGLDKPVTPKNFRKSNATWLAKLGKNESFIEDRQGRKRGSDAISHYVAMYGEDRAREYAAMHGQDVETE… |
| A0A832RVQ5 | 1-88 | None |
| A0A7C4GTB4 | 18-134 | None |
| M0HU60 | 57-179 | None |
| A0A3R7EDY9 | 429-542 | None |
| T0M9R1 | 157-274 | None |
| A0A7K4B8R0 | 1-78 | None |
| A0A7J4LMM2 | 47-184 | None |
| A0A848E654 | 192-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.