DPCstruct | MC24353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Standard deviation of domain lengths | 5.64 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 97.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 62.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376SZU1 | 45-137 | LRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFREICEICAAYDVSLSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAW… |
| A0A1V3WPI7 | 169-262 | LLRYVPLTAKRVTGIVSRGGSIMAAWCLAHHRESFLYTHFDELCDIFARYDVTFSLGDGLRPGSIADANDAAQFAELRTLGELTKIA… |
| A0A2R7QBU0 | 320-412 | None |
| A8FKN8 | 164-260 | None |
| A0A1B0C474 | 337-431 | None |
| A0A7C3ZFD7 | 162-241 | None |
| A0A379W0F0 | 343-425 | None |
| A0A0B8PDZ4 | 57-149 | None |
| A0A4Y6UBA1 | 273-366 | None |
| A0A800CXV0 | 91-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.