DPCstruct | MC24352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3H330 | 83-184 | FENAAATVSGVEAASRALQRRGKIPRERIAFVVFAGDGGTYDIGLQSLSGALERGHRFLYVCLNNEGYMNTGIQRSSATPLGAHTTT… |
| A0A7X9QBB5 | 43-149 | KAICIPPAGCAVLAYNYFDIDVCESAHGRGCAVATGFKRAQPDRFVFTYQGDGDMAAIGTAETIHAANRGELITSIFVNNAVYGMTG… |
| A0A7C8EDB8 | 1-99 | None |
| A0A2J6NFT6 | 21-143 | None |
| I8RLD3 | 53-145 | None |
| A0A7C1Q4X4 | 147-239 | None |
| A0A7X8MCU2 | 16-114 | None |
| Q1PX96 | 76-185 | None |
| A0A7J3I4T2 | 1-89 | None |
| A0A7C7VMJ5 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.