DPCstruct | MC24351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 8.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D6VVA2 | 1-100 | MIKNVLKALDAMFTDNAVEVDRSTFNAARICKVYGTVDCKDDDTEDRPHRIAKIISCPDEIVIVKKEQLQTIATMLPIEEKEVTGKK… |
| A0A1V5A9N4 | 153-254 | IDLPNDEMSSALVKRCLEVLDVMFSDRQVSVDTANFNAARIWKLYGTVSRKGDNTPDRPHRQSRVLSAPPAIETVGPDLLQHLAARL… |
| A0A7Y4R5E6 | 184-270 | None |
| I0SIR2 | 62-162 | None |
| Q2FL56 | 153-260 | None |
| A0A451AQC7 | 2-85 | None |
| U2NHL4 | 34-138 | None |
| A0A0X8XY92 | 69-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.