DPCstruct | MC2435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z1YA11 | 20-119 | EVDVPTEYKNGVKNRVYPQKCFDKSFDYMKENGELPNVKYVEGIYEGLVDHAWVEIDNKVVFEGTTQRFYDKEQYYQKRRLVKLVEL… |
| A0A6M5Z5X6 | 26-131 | VGTCPVRAYPKKCYIKALEYFLAHVADDVVLCHGEVAVAEWGLPFPHAWVELPGGIVFDGVAQMFCDRDGYQLTLGVAPERVRRYTP… |
| A0A5K8AIH8 | 11-106 | None |
| A0A3D0YAI4 | 9-103 | None |
| A0A517PY84 | 66-185 | None |
| R6Y121 | 66-165 | None |
| A0A1P8WGX7 | 171-271 | None |
| R6HQU0 | 113-211 | None |
| A0A7W0T0T6 | 40-141 | None |
| A0A381Y072 | 5-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.