DPCstruct | MC24349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 199 ± 42 aa |
| Standard deviation of domain lengths | 42.20 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A0AGW9 | 5-140 | QAGWRTGDLHLITAGARRLAGLGPGLTPAGDDLLVGWLAGIFFFGERSNLGVRAAAVGQAAAATAAARTTRLSAAWLRHAGVGEFAE… |
| A0A3D5GLL4 | 23-224 | NSETEQFPFSCVTDQDLDTYLIGDQVNVNVCHQLVDPLQTQFEICPTPDAVDPDFVISTVVESDDPRLLVLTERLSAGLNGRGAAFD… |
| A0A7C4CTK7 | 18-237 | None |
| A0A2M7AZN5 | 89-314 | None |
| A0A509INP6 | 1-236 | None |
| A0A7H9FAS5 | 6-142 | None |
| A0A7X8QPW2 | 42-224 | None |
| A0A2D5UD52 | 57-276 | None |
| A0A2P9I8J5 | 2-164 | None |
| A0A1V1WA63 | 3-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.