DPCstruct | MC24347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 134 ± 18 aa |
| Standard deviation of domain lengths | 18.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 93.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0627 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A133XKB5 | 48-176 | EWLAKGKPMNVRRSPSMMGLVSEVFRRSEGVHRSLSATHPLLAWGKDAQDFISGHQDTDRPFGPQSPFSKLLERNALILGFDAPFST… |
| W7CFU7 | 1-103 | MGVIPETFRKMKDVKRSSHPKYSFCAWGSDAAFITEKHALNFGFGEQSPLGRLYELQAKIVLFGVDHDKNTSLHLAEHRAKKIPHST… |
| A0A7V5CK94 | 63-181 | None |
| A0A2S5SQL7 | 96-213 | None |
| A0A645C409 | 2-119 | None |
| K0XEE7 | 282-416 | None |
| E6LSJ8 | 1-135 | None |
| A0A534W967 | 202-348 | None |
| A0A6I5VKC9 | 158-289 | None |
| A0A066YSD5 | 532-692 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.