DPCstruct | MC24342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 170 ± 24 aa |
| Standard deviation of domain lengths | 23.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3AXL8 | 10-177 | ADDGQDPRLSPAAEQAANAKSEKIKAELTKDAKPWWAGRYSEGDGMGANTSIILAPDAGFVYQWHGCLGIYDRNFGAVQEADGRVEL… |
| A0A1T3VFR6 | 1-161 | MRHERRILRELSALGGAHAWAGRYVYSDGYEGARLSLSPVAGAQAQLLSDVVGPDPRCDYALRELADGSLRLIPLHGAEACSPRVPT… |
| A0A6I1L611 | 287-478 | None |
| A0A316GHW4 | 20-181 | None |
| A0A4V0X3J4 | 1-171 | None |
| A0A5C8WHQ3 | 219-375 | None |
| A0A7Y4SUP8 | 1-212 | None |
| A0A3N2RCK8 | 1-214 | None |
| A0A108UDD4 | 3-140 | None |
| A0A4R6Z2Q6 | 48-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.