DPCstruct | MC24338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 6.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.95 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF01383- PF08846 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9UZH8 | 1-73 | MYGIATTGNSNMSDYNNRMVLLEVTGVLNANARNSHQIIKVPYSRLSQTVKRICRAGGKIVNVTMPSFSPSEV |
| K9SCU0 | 39-104 | NLSDSANRIFSIEVEGLRQSDASDRLSYSIRNSGTTSIRVPYSRLNEEMQRINRLGGKIVGVKAAS |
| A0A846D9H0 | 1-72 | None |
| B4VUI9 | 4-69 | None |
| A0A2P8WEW2 | 1-83 | None |
| A0A838VRA7 | 2-67 | None |
| T2JK55 | 1-55 | None |
| A0A841WE47 | 1-75 | None |
| A0A845ZUW8 | 1-70 | None |
| A0A6P0S9X0 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.