DPCstruct | MC24332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 174 ± 23 aa |
| Standard deviation of domain lengths | 22.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A258VAQ1 | 298-470 | EARPKDELRLGGMLSGHPENVNRRELKGAILALLWLGVWDIKEINTLLSITMNEKAETKLVGSFSDLGLSMGVKINRFPRDIKASLV… |
| A0A538NXS6 | 1-181 | MKRIDGWQWDHNPFVGSRQFQGLKIMMALLNNWDLKDSNNKIAVARDKKLADQESRYFVADLGGSFGKVSHLPRFLQFKPDRNNPKA… |
| M4VF64 | 209-421 | None |
| A0A847LND3 | 247-415 | None |
| A0A838U9T4 | 2-140 | None |
| A0A367ZRF2 | 414-552 | None |
| A0A350EUB8 | 381-561 | None |
| A0A2V7VB19 | 5-176 | None |
| A0A538NXU1 | 1-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.