DPCstruct | MC24331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 8.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7TQC1 | 2-69 | LRRLDQFREWHSLDDKRFCLVCGKIIVGGQIQINGGTRGNGPLRLSCPTERCNSIPMDWVLPTDELVA |
| A0A538NWC6 | 11-95 | AMALVSPNKLSDEEKLETLQRLDQFRQWHSLDEKRYCLVCGKIITGREIQVIWGTRGNGPLRIVCSTERCNAIPMDWVRPTVEVH |
| A0A4Q2YRQ3 | 9-89 | None |
| A0A2V6DVF9 | 1-76 | None |
| A0A2V6J0M4 | 2-73 | None |
| A0A2V6ISZ1 | 4-89 | None |
| A0A2V5ZQB9 | 52-140 | None |
| A0A2V5XKM7 | 3-84 | None |
| A0A2V6EHE8 | 19-100 | None |
| A0A2V6BYW9 | 35-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.