DPCstruct | MC2433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 106 ± 15 aa |
| Standard deviation of domain lengths | 15.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0SC42 | 24-142 | VPTLAALAQLASNRLVNPASNETELSIEARTILSITRKRGIIELKSNNTEFESAQRMLAVYVEESVDTHVMFRSRTEPEITVRFLDG… |
| A0A6M5Z495 | 16-123 | GIEGASPTVQQVRPSKRELALRREEAEILTRLLDSRTKMLQFVKVDSAAGFIVLIDTDPLSDAFDTDACLRYIEAFQRLREHGLLVN… |
| A0A3C1VDK6 | 4-89 | None |
| A0A3A3FFU4 | 247-341 | None |
| D0SAC0 | 77-198 | None |
| A0A450YM31 | 291-388 | None |
| A0A352F2G6 | 58-168 | None |
| A0A1I0CQP0 | 10-107 | None |
| A0A1B1YQ68 | 47-176 | None |
| B4WC78 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.