DPCstruct | MC24328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 12.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19939 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A810NRW6 | 3-105 | HGPTSPELARQVLDRYARAVGDAGRAAAAADPGVAAMLDQATATVGDALDPNRRPPLVELASYADGLTDRATSLGWRMPDPMTVDWR… |
| A0A431NEE9 | 1-127 | MRDVGVILSEWSARRTLRRMIDEFGLPGLVAARRSPGLGAALDQHVAAVRDLLDDRPFAHRSSVITRMPARELAPRLAAYARSLLEE… |
| A0A1C6U1F5 | 1-115 | None |
| A0A495VVR4 | 3-93 | None |
| A0A4R2J908 | 17-150 | None |
| A0A248YM68 | 12-115 | None |
| D2PQS5 | 21-127 | None |
| A0A3M9KZD2 | 55-172 | None |
| A0A097CSR7 | 73-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.