DPCstruct | MC24325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 169 ± 29 aa |
| Standard deviation of domain lengths | 28.66 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02538 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448UPH6 | 40-212 | DPIGYEKMFSKLRGGIVHARETAKRIAASPIVEQEGELCFTLYNAVGDSVLTSTGIIIHVGTMGSAIKYMVENNWEDNPGINDKDIF… |
| A0A482Y2G9 | 70-254 | RYEQLYARLRGDLVTARETSKEVSATPIVEQEGELCYGLFTPEGDSIAVSTGIIVHVHTMSEAIKFMINHDYEESPGIEPGDIFVNN… |
| A0A7L9WIY6 | 2-146 | None |
| A0A0M3IQS7 | 3-107 | None |
| B8IKP0 | 7-195 | None |
| A0A849WU36 | 3-164 | None |
| E7F6Z6 | 741-913 | None |
| A0A2K0UQ43 | 78-202 | None |
| A0A317WHJ4 | 630-765 | None |
| A0A212DNY4 | 232-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.