DPCstruct | MC24320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 142 ± 24 aa |
| Standard deviation of domain lengths | 23.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.73 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF04560- PF04997 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1PMS7 | 18-157 | FDVIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMG… |
| A0A0G0PPX0 | 5-135 | FKSMTDFDGLKIKLASPEEILSWSHGEVTKPETINYRSWRPEKDGLFCEKIFGPTKDYECYCGKYKKIRFKGVICDKCGVEVTTSKV… |
| A0A3D9JM13 | 754-873 | None |
| A0A7W0Q724 | 269-370 | None |
| A0A3R6IGC9 | 19-153 | None |
| A0A396I204 | 187-306 | None |
| A0A5D2CU41 | 7-92 | None |
| A0A381KMK2 | 3-166 | None |
| A0A7C6Y895 | 126-296 | None |
| A0A7G0X258 | 6-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.