DPCstruct | MC2432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 137 ± 6 aa |
| Standard deviation of domain lengths | 6.48 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845RM33 | 371-521 | RERLKHKVKTAAQMFHACDNQELYDSLPQRLEEALKDPTLAAECYAFLPEICAENAFDEVTYSETIDISVGGRPAATCYKNQLADYW… |
| A0A6M5Z2C6 | 3-141 | VREAILRAVPVFAAHTGGGPDALRSELTTAGLPAALAAEVVEFLPIAVARAMLNGMGVRFADFYVRQSAQGQVIGQKRLDEEPVYSA… |
| A0A3D2N4N5 | 274-409 | None |
| A0A2V2S8G4 | 2-127 | None |
| A0A517NS01 | 244-378 | None |
| A0A0Q7XAJ8 | 4-137 | None |
| A0A7W9IK58 | 5-135 | None |
| A0A3S2UIK4 | 8-154 | None |
| A0A7C9PFD7 | 119-256 | None |
| A0A6L9LQE5 | 26-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.