DPCstruct | MC24319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Standard deviation of domain lengths | 8.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1I1J9 | 1-109 | EVERLSLFDPLTGQIEQVVPRFTIYPKSHYVTPRERIMQAMEEIKVDLADRRKVLLANNKLLEEQRLTQRTQFDLEMMNELGYCSGI… |
| A0A645F1N9 | 63-169 | RISIFDVLTGLIEETVEVVTIYPSKIFVTTEEQINRGMKLIREELHDRLKYFNENGKYLEAQRLEQRTFFDLEMMKEVGYCSGIENY… |
| A0A0G0D4E7 | 288-389 | None |
| A0A090MU98 | 376-496 | None |
| A0A6P4G5Q8 | 284-384 | None |
| A0A1A9YLU7 | 179-289 | None |
| A0A0G0NRW5 | 207-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.