DPCstruct | MC24318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 5.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7RRS7 | 1-61 | MLCLFAPATFANEDASEPNVKKSKNDICHDKSSRSYKRTKNYTPYETIKECLASGGRLPKK |
| A0A139DLH5 | 6-64 | TVGLAFILLLVCTSVSAELVKKSSSGLCHPPESSWYERTKNYEAFDSIKTCLDSGGLLP |
| A0A4P5WGB5 | 32-100 | None |
| B6EIQ0 | 201-262 | None |
| A0A2G4IIZ8 | 12-73 | None |
| A0A1X7C109 | 52-116 | None |
| A0A2Z4JQ53 | 1-66 | None |
| A0A0G0Y9C8 | 25-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.