DPCstruct | MC24316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 53.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02759 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3ABF3 | 7-90 | RSVSGAVDLIMAHFGRSRDPESKVRLGSSAHSPAVAGLVLEHLCPAIQGVLEDGLRDHKLDYVIGQCRNHAWKVVEISTRMGTR |
| A0A7J8EG27 | 120-204 | KAVNTAVDLIVAHFGTSRDPGVKAKLGNSSVSPNVGHLVLKYLCPAVRAVLEDGLKAFVLDVIIGQRKNMPWSVVEASTQLGPST |
| A0A672PRQ3 | 1-71 | None |
| S9XPP4 | 288-374 | None |
| A0A672YN02 | 176-264 | None |
| A0A3B4Y0I1 | 3-85 | None |
| A0A498MXE4 | 602-700 | None |
| A0A1U7T1U5 | 11-94 | None |
| A0A6I9YY69 | 998-1082 | None |
| A0A667ZYZ3 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.