DPCstruct | MC24311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 8.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 17.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01867 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T1CDU0 | 1-65 | MLKKTLLIENKSSISAKNLQLIVKSETREGTVPIEEIGFLVLDHPEIYISIPAMNILIQNHTNIK |
| A0A4R1GGY9 | 6-89 | KMRKSIFVVTPSVVIKKDGNALIFELKGKRERLPIGVVEHLFLFVGIEITTKALRFLLSNGRYVFYLNSFGKLVDLSVLKLLTS |
| A0A2K3ZAS0 | 2-88 | None |
| A0A847T5G5 | 1-83 | None |
| A0A0E2DZG5 | 200-287 | None |
| A0A7V8BEK9 | 15-113 | None |
| A0A1Y4VDT1 | 42-122 | None |
| A0A7V3AD77 | 137-228 | None |
| A0A5R8QK29 | 64-144 | None |
| A0A4Q8RMQ9 | 16-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.