DPCstruct | MC2431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 125 ± 10 aa |
| Standard deviation of domain lengths | 9.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M5Z029 | 5-126 | LLVVDRIDDGHQLLIELVRSGLDVSAAAWVKTSEEGLWFLYIGSPSVTAGNLADAYRSVYACLRHIPNSSIEMSEVKLVHASNPIVR… |
| A0A3D3Z3B9 | 6-121 | LVTDAQTLTRSLDETMIKPKGVMLARSSETGESKLWVVPSSNIDKREFYGLVAQAISAEDLSALDVGMVELVDMARADRMGFRQLVR… |
| A0A315XF39 | 4-136 | None |
| A7BYP9 | 1-129 | None |
| A0A3C0I148 | 3-133 | None |
| A0A147HQW5 | 1-144 | None |
| A0A3D4V6M8 | 138-258 | None |
| A0A1W9W3S5 | 1-127 | None |
| A0A1M3PGA7 | 2-127 | None |
| A0A519Q3V8 | 5-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.