DPCstruct | MC24309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 204 ± 26 aa |
| Standard deviation of domain lengths | 25.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A742KST2 | 340-570 | ICAVPEKEDYTAKDIDEKSELTIWTNTKYKAMTEVLEAGNIESMIDYLKYLDSVSVSPALLADMINELWSEAAVNADYNGLPFKEVS… |
| A0A6G6TIK4 | 1-210 | MGKKQVVFHDGIPYPADNIDLDDLLKSLSYTEVSLDEIANLLNAILMNASLQPDYKGIPFNSSNAITKDEIKNLLKENNESQTVYFH… |
| A0A377JL41 | 7-182 | None |
| A0A6L9GGX1 | 1-149 | None |
| A0A0H3I6J6 | 100-291 | None |
| A0A381GMY7 | 1-237 | None |
| A0A854BQQ7 | 230-425 | None |
| A0A069N945 | 171-401 | None |
| A0A5W2LVP8 | 59-272 | None |
| A0A606C3Q7 | 123-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.