DPCstruct | MC24307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 126 ± 18 aa |
| Standard deviation of domain lengths | 18.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.89 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0023- CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A075FGY6 | 75-188 | VDLNDRALRRININLGGVANGFPREDGFDITVASEIMAIFCLSNNLKDLEEKIGNITVAYTREKKPIYAKDLNAHGPMTVLLKEAIK… |
| A0A2E8GRQ2 | 6-126 | IGMSIDLENITWRRTIDLCDRQLRNCEVGLGSKFDGFAHKTGFDIVAASEIMTIMALAKDMADLRERIGRIVVAYNRSNKPVFAREL… |
| A0A0D8XDL0 | 18-164 | None |
| A0A4W5PLI1 | 40-140 | None |
| A0A2U1PIV0 | 157-277 | None |
| A0A5S9ME17 | 78-193 | None |
| A0A101I5C9 | 226-389 | None |
| A0A837AU06 | 169-277 | None |
| A0A1A6H879 | 212-345 | None |
| A0A060X745 | 554-667 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.