DPCstruct | MC24305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5X1J1 | 2-63 | KKHVVCFGDSNTHGYCAKTGGRFDESQRWTCLLQKKLGDQWLILEEGLSGRTTTFDDPIHEA |
| A0A2E8CDX9 | 1-65 | MLARSKSVLCFGDSITHGLKCAGGVHKRYDRNVRWPGVLGNALGPNWEIIEEGHCGRTIDRDDPI |
| A0A316GJH3 | 3-66 | None |
| A0A090P7P4 | 6-69 | None |
| A0A1I0DF82 | 2-59 | None |
| D4CMF7 | 2-53 | None |
| A0A1I4M5Z7 | 2-57 | None |
| A0A819BLI4 | 249-309 | None |
| A0A1G0G2Z4 | 2-60 | None |
| A0A090R1N5 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.