DPCstruct | MC24301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 154 |
|---|---|
| Mean domain length (aa) | 190 ± 42 aa |
| Standard deviation of domain lengths | 42.42 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.95 |
| Pfam Score | 93.97 |
| Assigned Pfam label(s) | PF00476- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A358RUV8 | 166-367 | AAFCRMLPFYPDRELELIHLTLQMMCEPLLMIDVPRVIQCRDNAIAERDRIIRESGLSEKLLSSNAQFEKWIRAQGLPVPLKPSPTQ… |
| A0A7R9GPW6 | 369-574 | LLAVMELRGISVDKAKLEKMNVLLKGQIDLLEAAAHKAAGKPFHLNSTVQLRTILYEELKLDQKHSIHIKETISLKAKSTSEPVLRQ… |
| A0A6J3CCU6 | 472-600 | None |
| A0A1Q7B4R5 | 1-303 | None |
| A0A832NLT4 | 421-619 | None |
| A0A7N0TLR1 | 510-661 | None |
| T0CTH0 | 2-243 | None |
| A0A855HML7 | 1-106 | None |
| A0A831YJ17 | 2-193 | None |
| A0A0R1ZW76 | 1-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.