DPCstruct | MC2430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 115 ± 4 aa |
| Standard deviation of domain lengths | 4.15 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 94.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 30.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A511N157 | 4-116 | ELQAALSTLLDRLNAVAENHGEIFDTDVREQMFDAVYLSVLKPRPGYTLPERFGMYEPEGNRAVREALEAYAQQVLPIFEQLQFTPQ… |
| A0A6M5YZD7 | 1-126 | MKELLLQLLQRLQAIGTRNGEIYDTECRDAMAAAVFSTFLLPEAEYQFPKEFGLCTADANQAVRGALLEYVTAARELAPVARLCTFQ… |
| A0A3E0NXI8 | 27-141 | None |
| L7VQB8 | 124-233 | None |
| A0A8A7FFM9 | 2-116 | None |
| A0A402CWJ5 | 1-113 | None |
| A0A517Z4M4 | 2-114 | None |
| A0A6S6U1J6 | 112-222 | None |
| A0A517VA38 | 177-291 | None |
| A0A2T6DBE7 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.