DPCstruct | MC243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 131 ± 9 aa |
| Standard deviation of domain lengths | 9.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 21.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08570 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4VW76 | 4-122 | LTQNVTWIAVIIGALLAFFAGWAWYSPKLFGKRWAQGLAIDLAAAPPVAAMMLQGLGLFLLSWFVAVTAASGALMTLLLGALAFVVL… |
| A0A2V9J391 | 8-146 | ETMKTNYPAVAVSAVVYWLLGAVWFGVLFSKPWLALEHMSEAQAQSMNPVLPYIISFALNLLIAFVLSQICIWRNANTAGQGAGVGA… |
| A0A7T9E6F1 | 7-137 | None |
| A0A2E1HDL9 | 94-216 | None |
| A0A3N5L7Q4 | 41-172 | None |
| A0A432HRD2 | 5-135 | None |
| A0A1F7AGL7 | 4-135 | None |
| A0A2A4LJQ7 | 53-186 | None |
| A0A5R8QFC1 | 27-144 | None |
| A0A369S8W5 | 46-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.