DPCstruct | MC24299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 315 ± 36 aa |
| Standard deviation of domain lengths | 35.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DJ91 | 38-363 | FTSTPSISVLIRHGFVECLDSEQDDPMEEEDEDGFGIHCHIKEAILKFLQQSVSHSAPNVAHYLLGFDTKKDIKKMVFQQPGVQEFP… |
| A0A016RS97 | 163-518 | MVELLRARRMVSRNSRGIRNVLNPAVVRYTVQDMVALELNESDPIRLRGEAALVVLETLSDSIETDPTGNNLCFLLFGFKTSVDESG… |
| D8LWQ7 | 2-298 | None |
| W2SS45 | 3-269 | None |
| A0A835RE33 | 98-452 | None |
| A0A0B1PLZ0 | 295-658 | None |
| A0A4C1TBL5 | 2-259 | None |
| A0A811W8A3 | 84-371 | None |
| A0A453NQE6 | 9-359 | None |
| A0A2A2JVL3 | 213-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.