DPCstruct | MC24296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 163 ± 26 aa |
| Standard deviation of domain lengths | 25.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416B6M1 | 8-150 | EKYLNEIPENIEKCKETGDRIVFGYTSDLDVLLTYNEDEFNKLVDTYVKGDIYRDGDENITDLESFSRIIAYYMANGLGGEADITDY… |
| A0A7R9D2E8 | 7-151 | LGATGTKELLDLYILDLGYRKQLDDVLKNRLNSILEGLVKVEKEHSIISKKVAIGYGACIDLFVDGSDLLNYEAVADIPEHFNDISS… |
| A0A146L9F5 | 1-148 | None |
| W2SLT9 | 334-503 | None |
| A0A2G9S9J2 | 1-154 | None |
| A0A5C6NKQ6 | 350-492 | None |
| A0A6V7XSV9 | 184-334 | None |
| A0A6J0Y6D2 | 5-169 | None |
| F4PK35 | 47-231 | None |
| A0A7J6RXB2 | 31-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.