DPCstruct | MC24293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 117 ± 20 aa |
| Standard deviation of domain lengths | 20.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 38.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9CX66 | 20-135 | EVGEEYDPTELVCGACSDVSRAQMCPKHGTDFLEYKCRYCCSTAVFFCFGTTHFCNACHDDFQRVTNIPRLELPTCPAGPKAKQLEG… |
| A0A0K0D294 | 11-112 | LVCGGCSAPPGTDVCGRHGAEYLEYKCRYCCSIAVYFCFGTTHFCAPCHDDFQRLVCLPRSQFPPCPTGPRATPSEGPCPLRRPHPP… |
| D3AW00 | 476-580 | None |
| R1D1V4 | 229-324 | None |
| D3AZM8 | 500-613 | None |
| A0A4W4FJ93 | 364-497 | None |
| A0A0V0Q7Z6 | 509-588 | None |
| F4PV64 | 993-1106 | None |
| F4PW33 | 618-736 | None |
| A0A0D8XSF4 | 818-948 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.