DPCstruct | MC2429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 138 ± 12 aa |
| Standard deviation of domain lengths | 11.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19372 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5FU55 | 8-140 | IPRRISLLPEFQMTDAEWEALMIPINLAFFYRDSASGRMVAMYPSPAGATESLLSLDSWEEIRSQNHALQTLEPDVEALLVDRVSAE… |
| A0A6M5YPQ7 | 4-133 | RVAALPDLRLTDEQLTAMGVPVGLAFFSRVGATGGAVAVYPSPAGPLESPLEPAAWDALAADNPLLRELEPDVEALIVNRVRGAREH… |
| A0A1C6SWX9 | 69-209 | None |
| R1HZN1 | 51-194 | None |
| A0A2T0MKP4 | 112-229 | None |
| A0A6B1K0L4 | 24-168 | None |
| A0A7V9I9M7 | 1-125 | None |
| A0A3T1B998 | 85-220 | None |
| A0A7W1PKP6 | 32-175 | None |
| A0A3G4VSK8 | 125-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.