DPCstruct | MC24289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 127 ± 23 aa |
| Standard deviation of domain lengths | 23.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.35 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0003- PF19525 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4RHB0 | 98-182 | NEPNIPQDPRYWTRHDVVTWLQYMAEMHHLPNVATDRFIMNGKALCLMTVSMFLDRVPLGGKLLYKDFQLRLARAMYSNESYPNC |
| A0A7R9CDE7 | 20-143 | SLPSSPVYIGRLHPRLWSETHVAHWLYWAIREFSLEGVPLNQFHMRGKDICAMGKEAFLARAPPFMGDILWEHLEILQKGTYRYVGG… |
| A0A821IZ95 | 16-117 | None |
| A0A7E5X234 | 11-163 | None |
| A0A5E4Q3E6 | 23-172 | None |
| A0A2A4K7D9 | 61-237 | None |
| A0A2Y9DR22 | 1-113 | None |
| A0A085NS05 | 77-233 | None |
| A0A4W3GRH4 | 62-187 | None |
| A0A6I9YR22 | 29-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.