DPCstruct | MC24288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 311 ± 80 aa |
| Standard deviation of domain lengths | 79.92 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 74.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0LSK3 | 12-264 | TASIENVAQKIYSKILYISRSNSFKAVKLNIYDPCKIDELKKFVIYEPEHRPKCLSSASIDLNQNPETNTGYRYGAKEVWEHLLNLS… |
| A0A7R9CB44 | 21-339 | LSSQHLDGDTSSLVGRSADVYEEFARWEAYDDAQDNFCDTNEEDDDIEYVDLLLNPERYTGYKGKSAHRIWHSIYMENCFRPKNSYG… |
| A0A7J7IHJ4 | 7-240 | None |
| A0A6P3ZE88 | 3-248 | None |
| A0A7J9EPI4 | 1-177 | None |
| Q5CVQ4 | 53-373 | None |
| L1LCF8 | 6-239 | None |
| A0A3B5QXA0 | 28-363 | None |
| A0A7S3ZLP6 | 27-230 | None |
| A0A0M4EA12 | 89-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.