DPCstruct | MC24287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 216 ± 46 aa |
| Standard deviation of domain lengths | 46.06 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.47 |
| Pfam Score | 96.01 |
| Assigned Pfam label(s) | CL0361- PF13821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1SFV1 | 331-485 | LDKVILYLRIVHSYDYYAATEYTGEDDMPQRIGIMFARPMLPTSFGDQPQELLKEFIEAQKTRVDQSLEKPTLSEAEQKQLGMRNAD… |
| A0A7R9CAL3 | 2-226 | VLDKLLLYLRIVHSVDYYNHCEYPNEDEMPNRCGIMHARSIPPISKVIQFFTVTCLSNRLVSQQEISDYCRMFEQKVASFLQPNTIV… |
| A0A6P5GMA3 | 80-259 | None |
| C3ZTZ3 | 140-361 | None |
| A0A061R2X8 | 315-547 | None |
| A0A183HNK7 | 1-164 | None |
| A0A817CHE3 | 792-1048 | None |
| A0A2K3P1B6 | 173-425 | None |
| A0A316YN29 | 450-676 | None |
| A0A183MVV4 | 338-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.