DPCstruct | MC24284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 216 ± 33 aa |
| Standard deviation of domain lengths | 33.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7TWG7 | 26-261 | NRLMVVFFSLLFQKLLLLFSKLLAKLGSIVEFCLNLVSSNGGLLMLQGKMEIPKAESEKFMSFIGQIDRRVELDSSIKAGDYRYFSS… |
| A0A2C9UWY6 | 43-271 | TTVSLPPNFLIVNPNKGRKRDIFKYMVGNNTKSGMNFLDSSEETVKGGAAVDHRWILLVSIIIRRILALINTPLKYFGYLVDFFLNL… |
| A0A3Q7FAA0 | 6-223 | None |
| A0A6A2XCH7 | 1-267 | None |
| A0A5D3D9F9 | 4-218 | None |
| A0A5E4E9T4 | 2-171 | None |
| A0A5J5TZ88 | 1-235 | None |
| A0A2P5XM12 | 1-210 | None |
| A0A803M9M4 | 8-260 | None |
| A0A6A1W509 | 3-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.