DPCstruct | MC24280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 92 ± 14 aa |
| Standard deviation of domain lengths | 14.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5RKA1 | 161-246 | KRQAEKRAGGKALKRLNKWETLINRHQNDADFEKLKVVVDFFKDQINVARDWGKTKGNDYWQSPIETLVRGKGDCDDFAMAHYVSL |
| A0A0K8P8T9 | 22-103 | AAPLGPRAVAGARAMQQLIAAGSQATDDSRVRATNQFFNDAFAYADDMEIWGQKDYWATPLEAFSKGMADCEDYAIAKYFSL |
| A0A2E9QV53 | 197-288 | None |
| A0A6L4WQ67 | 4-79 | None |
| A0A7X5NKN3 | 1-91 | None |
| A0A2N3IVM9 | 1-91 | None |
| A0A6S5YR51 | 30-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.